Finally also articles at IzzyOnDroid!

Izzy

No, this is not a “common Android blog”. Rumors on Rice-Phones, which have fallen (down) in some Chinese area, are searched for here in vain. Fruit-Cocktails made from apples and black berries you won’t find here, nor “the latest (trendy) thing”. Instead, I want to concentrate on more enduring topics encountered by smartphone- and tablet users in their everyday life.

Doing so, I prefer to offer quality over quantity (I hope I succeed in this). What’s on my mind, you can tell by available tags:

apps: Introducing some interesting app every now and then (see review), and link to that from the corresponding App Lists; tips on both, maybe also pointing out some "interesting categories" (aka “there’s an app for that, too” )
markets: Shed some light on sources to (safely and securely) obtain apps from
privacy: Topics around privacy – e.g., how to guard against “Snoopers”
review: Not only apps can be reviewed – though it probably will be mostly them here
security: Topics relevant to security. Using this tag, I’m likely to talk about permissions, amongst other things

Naturally, tags overlap. Specifically on my mind:

markets + security: What to consider in this context? Why is the “simplification” displaying permissions on app-install using the Google Play Store app rather a step into the wrong direction – and how could it have been done better? How safe are “other market-places”?
apps + review: No need to explain this, right?
apps + privacy: What to look out for, how to protect? Surely, this includes things like permission-blockers and firewalls

“Quality over quantity” also means: Don’t expect “10 posts daily”. Rather be prepared for the fact that, between two articles, it might well take several weeks. And moreover, I won’t publish all articles in English and German: most articles will probably be available in German only. So if you’re capable of reading German, or can live with a “Google translated variant”, you might wish to head over to the German list of topics.

Of course, I’m also looking forward to your feedback. Clicking the "blue bird" at the top of this page, you can find me at Twitter. For E-Mails, simply put my nick (I’m Izzy) in front of the “monkey clamp”, then add the domain qumran.org, put the result in the “To:” field of the mail, the feedback in the text field, and hit the “Send” button .

And now, continue to enjoy browsing through the pages of IzzyOnDroid!

appsinternamarketsprivacyreviewsecurity

2014-07-15