Mastodon IzzyOnDroid


Say thanks!
↓ Your product here? ↓
Das Inoffizielle Android-HandbuchAndroid kennenlernen, Tipps & TricksDas Inoffizielle Android-Handbuch
Android kennenlernen, Tipps & Tricks
Für EUR 16,99 bei Amazon kaufen
Das Inoffizielle Android SystemhandbuchTiefer ins System einsteigenDas Inoffizielle Android Systemhandbuch
Tiefer ins System einsteigen
Für EUR 7,00 bei Amazon kaufen
Die besten Android-AppsDen Androiden austattenDie besten Android-Apps
Den Androiden austatten
Für EUR 5,00 bei Amazon kaufen
 
enhelp

Jetzt auch Artikel bei IzzyOnDroid!

Izzy
Izzy

Nein, dies ist kein “gewöhnliches Blog”. Gerüchte zu Reis-Phones, die in der chinesischen Gegend (um)gefallen sind, wird man hier vergebens suchen. Frucht-Cocktails aus Äpfeln und Schwarzbeeren gibt es hier ebensowenig wie den “letzten (Zalando-) Schrei”. Stattdessen will ich mich um langlebigere Themen kümmern, denen Smartphone- und Tablet-Anwender im Android-Alltag begegnen.

Dabei möchte ich “Klasse statt Masse” bieten – und hoffe, dass mir das auch gelingt. An was ich in diesem Zusammenhang so gedacht habe, zeigen die verfügbaren Tags:

Naturgemäß gibt es zwischen den Tags Überschneidungen. Speziell habe ich dabei im Auge:

“Klasse statt Masse” heißt allerdings auch: Mit “10 Artikeln täglich” kann man sicher nicht rechnen. Eher sollte davon ausgegangen werden, dass zwischen zwei Artikeln auch einmal ein paar Wochen vergehen können.

Auf Feedback freue ich mich natürlich ebenfalls. Über den “blauen Vogel” am oberen Ende der Seite findet man mich bei Twitter. Für E-Mails einfach meinen Nick (ich bin der Izzy) vor den “Klammeraffen”, die Domain qumran.org dahinter, beides zusammen ins Adressfeld, und das Feedback in den Text der Mail.

So, und nun weiterhin viel Spaß beim Stöbern auf den Seiten von IzzyOnDroid!

appsinternamarketsprivacyreviewsecurity

2014-07-15