Mastodon IzzyOnDroid


Say thanks!

Privacy Links
↓ Your product here? ↓
Das Inoffizielle Android-HandbuchAndroid kennenlernen, Tipps & TricksDas Inoffizielle Android-Handbuch
Android kennenlernen, Tipps & Tricks
Buy at Amazon for EUR 2,00
Das Inoffizielle Android SystemhandbuchTiefer ins System einsteigenDas Inoffizielle Android Systemhandbuch
Tiefer ins System einsteigen
Buy at Amazon for EUR 7,00
Die besten Android-AppsDen Androiden austattenDie besten Android-Apps
Den Androiden austatten
Buy at Amazon for EUR 5,00
 
dehelp

Finally also articles at IzzyOnDroid!

Izzy
Izzy

No, this is not a “common Android blog”. Rumors on Rice-Phones, which have fallen (down) in some Chinese area, are searched for here in vain. Fruit-Cocktails made from apples and black berries you won’t find here, nor “the latest (trendy) thing”. Instead, I want to concentrate on more enduring topics encountered by smartphone- and tablet users in their everyday life.

Doing so, I prefer to offer quality over quantity (I hope I succeed in this). What’s on my mind, you can tell by available tags:

Naturally, tags overlap. Specifically on my mind:

“Quality over quantity” also means: Don’t expect “10 posts daily”. Rather be prepared for the fact that, between two articles, it might well take several weeks. And moreover, I won’t publish all articles in English and German: most articles will probably be available in German only. So if you’re capable of reading German, or can live with a “Google translated variant”, you might wish to head over to the German list of topics.

Of course, I’m also looking forward to your feedback. Clicking the "blue bird" at the top of this page, you can find me at Twitter. For E-Mails, simply put my nick (I’m Izzy) in front of the “monkey clamp”, then add the domain qumran.org, put the result in the “To:” field of the mail, the feedback in the text field, and hit the “Send” button  :D .

And now, continue to enjoy browsing through the pages of IzzyOnDroid!

appsinternamarketsprivacyreviewsecurity

2014-07-15